[ aws . route53domains ]
This operation returns detailed information about a specified domain that is associated with the current Amazon Web Services account. Contact information for the domain is also returned as part of the output.
See also: AWS API Documentation
get-domain-detail
--domain-name <value>
[--cli-input-json | --cli-input-yaml]
[--generate-cli-skeleton <value>]
[--debug]
[--endpoint-url <value>]
[--no-verify-ssl]
[--no-paginate]
[--output <value>]
[--query <value>]
[--profile <value>]
[--region <value>]
[--version <value>]
[--color <value>]
[--no-sign-request]
[--ca-bundle <value>]
[--cli-read-timeout <value>]
[--cli-connect-timeout <value>]
[--cli-binary-format <value>]
[--no-cli-pager]
[--cli-auto-prompt]
[--no-cli-auto-prompt]
[--cli-error-format <value>]
--domain-name (string) [required]
The name of the domain that you want to get detailed information about.
Constraints:
- max:
255
--cli-input-json | --cli-input-yaml (string)
Reads arguments from the JSON string provided. The JSON string follows the format provided by --generate-cli-skeleton. If other arguments are provided on the command line, those values will override the JSON-provided values. It is not possible to pass arbitrary binary values using a JSON-provided value as the string will be taken literally. This may not be specified along with --cli-input-yaml.
--generate-cli-skeleton (string)
Prints a JSON skeleton to standard output without sending an API request. If provided with no value or the value input, prints a sample input JSON that can be used as an argument for --cli-input-json. Similarly, if provided yaml-input it will print a sample input YAML that can be used with --cli-input-yaml. If provided with the value output, it validates the command inputs and returns a sample output JSON for that command. The generated JSON skeleton is not stable between versions of the AWS CLI and there are no backwards compatibility guarantees in the JSON skeleton generated.
--debug (boolean)
Turn on debug logging.
--endpoint-url (string)
Override command’s default URL with the given URL.
--no-verify-ssl (boolean)
By default, the AWS CLI uses SSL when communicating with AWS services. For each SSL connection, the AWS CLI will verify SSL certificates. This option overrides the default behavior of verifying SSL certificates.
--no-paginate (boolean)
Disable automatic pagination. If automatic pagination is disabled, the AWS CLI will only make one call, for the first page of results.
--output (string)
The formatting style for command output.
--query (string)
A JMESPath query to use in filtering the response data.
--profile (string)
Use a specific profile from your credential file.
--region (string)
The region to use. Overrides config/env settings.
--version (string)
Display the version of this tool.
--color (string)
Turn on/off color output.
--no-sign-request (boolean)
Do not sign requests. Credentials will not be loaded if this argument is provided.
--ca-bundle (string)
The CA certificate bundle to use when verifying SSL certificates. Overrides config/env settings.
--cli-read-timeout (int)
The maximum socket read time in seconds. If the value is set to 0, the socket read will be blocking and not timeout. The default value is 60 seconds.
--cli-connect-timeout (int)
The maximum socket connect time in seconds. If the value is set to 0, the socket connect will be blocking and not timeout. The default value is 60 seconds.
--cli-binary-format (string)
The formatting style to be used for binary blobs. The default format is base64. The base64 format expects binary blobs to be provided as a base64 encoded string. The raw-in-base64-out format preserves compatibility with AWS CLI V1 behavior and binary values must be passed literally. When providing contents from a file that map to a binary blob fileb:// will always be treated as binary and use the file contents directly regardless of the cli-binary-format setting. When using file:// the file contents will need to properly formatted for the configured cli-binary-format.
--no-cli-pager (boolean)
Disable cli pager for output.
--cli-auto-prompt (boolean)
Automatically prompt for CLI input parameters.
--no-cli-auto-prompt (boolean)
Disable automatically prompt for CLI input parameters.
--cli-error-format (string)
The formatting style for error output. By default, errors are displayed in enhanced format.
To use the following examples, you must have the AWS CLI installed and configured. See the Getting started guide in the AWS CLI User Guide for more information.
Unless otherwise stated, all examples have unix-like quotation rules. These examples will need to be adapted to your terminal’s quoting rules. See Using quotation marks with strings in the AWS CLI User Guide .
To get detailed information about a specified domain
The following get-domain-detail command displays detailed information about the specified domain.
This command runs only in the us-east-1 Region. If your default region is set to us-east-1, you can omit the region parameter.
aws route53domains get-domain-detail \
--region us-east-1 \
--domain-name example.com
Output:
{
"DomainName": "example.com",
"Nameservers": [
{
"Name": "ns-2048.awsdns-64.com",
"GlueIps": []
},
{
"Name": "ns-2049.awsdns-65.net",
"GlueIps": []
},
{
"Name": "ns-2050.awsdns-66.org",
"GlueIps": []
},
{
"Name": "ns-2051.awsdns-67.co.uk",
"GlueIps": []
}
],
"AutoRenew": true,
"AdminContact": {
"FirstName": "Saanvi",
"LastName": "Sarkar",
"ContactType": "COMPANY",
"OrganizationName": "Example",
"AddressLine1": "123 Main Street",
"City": "Anytown",
"State": "WA",
"CountryCode": "US",
"ZipCode": "98101",
"PhoneNumber": "+1.8005551212",
"Email": "ssarkar@example.com",
"ExtraParams": []
},
"RegistrantContact": {
"FirstName": "Alejandro",
"LastName": "Rosalez",
"ContactType": "COMPANY",
"OrganizationName": "Example",
"AddressLine1": "123 Main Street",
"City": "Anytown",
"State": "WA",
"CountryCode": "US",
"ZipCode": "98101",
"PhoneNumber": "+1.8005551212",
"Email": "arosalez@example.com",
"ExtraParams": []
},
"TechContact": {
"FirstName": "Wang",
"LastName": "Xiulan",
"ContactType": "COMPANY",
"OrganizationName": "Example",
"AddressLine1": "123 Main Street",
"City": "Anytown",
"State": "WA",
"CountryCode": "US",
"ZipCode": "98101",
"PhoneNumber": "+1.8005551212",
"Email": "wxiulan@example.com",
"ExtraParams": []
},
"AdminPrivacy": true,
"RegistrantPrivacy": true,
"TechPrivacy": true,
"RegistrarName": "Amazon Registrar, Inc.",
"WhoIsServer": "whois.registrar.amazon",
"RegistrarUrl": "http://registrar.amazon.com",
"AbuseContactEmail": "abuse@registrar.amazon.com",
"AbuseContactPhone": "+1.2062661000",
"CreationDate": 1444934889.601,
"ExpirationDate": 1602787689.0,
"StatusList": [
"clientTransferProhibited"
]
}
DomainName -> (string)
The name of a domain.
Constraints:
- max:
255
Nameservers -> (list)
The name servers of the domain.
(structure)
Name server includes the following elements.
Name -> (string) [required]
The fully qualified host name of the name server.
Constraint: Maximum 255 characters
Constraints:
- max:
255- pattern:
[a-zA-Z0-9_\-.]*GlueIps -> (list)
Glue IP address of a name server entry. Glue IP addresses are required only when the name of the name server is a subdomain of the domain. For example, if your domain is example.com and the name server for the domain is ns.example.com, you need to specify the IP address for ns.example.com.
Constraints: The list can contain only one IPv4 and one IPv6 address.
(string)
Constraints:
- max:
45
AutoRenew -> (boolean)
Specifies whether the domain registration is set to renew automatically.
AdminContact -> (structure)
Provides details about the domain administrative contact.
FirstName -> (string)
First name of contact.
Constraints:
- max:
255LastName -> (string)
Last name of contact.
Constraints:
- max:
255ContactType -> (string)
Indicates whether the contact is a person, company, association, or public organization. Note the following:
- If you specify a value other than
PERSON, you must also specify a value forOrganizationName.- For some TLDs, the privacy protection available depends on the value that you specify for
Contact Type. For the privacy protection settings for your TLD, see Domains that You Can Register with Amazon Route 53 in the Amazon Route 53 Developer Guide- For .es domains, the value of
ContactTypemust bePERSONfor all three contacts.Possible values:
PERSONCOMPANYASSOCIATIONPUBLIC_BODYRESELLEROrganizationName -> (string)
Name of the organization for contact types other than
PERSON.Constraints:
- max:
255AddressLine1 -> (string)
First line of the contact’s address.
Constraints:
- max:
255AddressLine2 -> (string)
Second line of contact’s address, if any.
Constraints:
- max:
255City -> (string)
The city of the contact’s address.
Constraints:
- max:
255State -> (string)
The state or province of the contact’s city.
Constraints:
- max:
255CountryCode -> (string)
Code for the country of the contact’s address.
Possible values:
ACADAEAFAGAIALAMANAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTPTRTTTVTWTZUAUGUSUYUZVAVCVEVGVIVNVUWFWSYEYTZAZMZWZipCode -> (string)
The zip or postal code of the contact’s address.
Constraints:
- max:
255PhoneNumber -> (string)
The phone number of the contact.
Constraints: Phone number must be specified in the format “+[country dialing code].[number including any area code>]”. For example, a US phone number might appear as
"+1.1234567890".Constraints:
- max:
30Email -> (string)
Email address of the contact.
Constraints:
- max:
254Fax -> (string)
Fax number of the contact.
Constraints: Phone number must be specified in the format “+[country dialing code].[number including any area code]”. For example, a US phone number might appear as
"+1.1234567890".Constraints:
- max:
30ExtraParams -> (list)
A list of name-value pairs for parameters required by certain top-level domains.
(structure)
ExtraParam includes the following elements.
Name -> (string) [required]
The name of an additional parameter that is required by a top-level domain. Here are the top-level domains that require additional parameters and the names of the parameters that they require:
.au, .com.au, and .net.au
AU_REGISTRANT_NAME
AU_ID_NUMBER
AU_ID_TYPEValid values include the following:
ABN(Australian business number)ACN(Australian company number)TM(Trademark number)
AU_ELIGIBILITY_TYPEValid values include the following:
- CHARITABLE_TRUST (Charitable trust)
- CHARITY (Charity)
- CHILD_CARE_CENTRE (Child care centre)
- CLUB (Club)
- COMMERCIAL_STATUTORY_BODY (Commercial statutory body)
- COMMONWEALTH_ENTITY (Commonwealth entity)
- COMPANY (Company)
- COMPANY_LIMITED_BY_GUARANTEE (Company limited by guarantee)
- EDUCATIONAL_INSTITUTION (Educational institution)
- GOVERNMENT_SCHOOL (Government school)
- HIGHER_EDUCATION_INSTITUTION (Higher education institution)
- INCORPORATED_ASSOCIATION (Incorporated association)
- INDIGENOUS_CORPORATION (Indigenous corporation)
- INDUSTRY_BODY (Industry body)
- INDUSTRY_ORGANISATION (Industry association)
- NATIONAL_BODY (National body)
- NON_DISTRIBUTING_COOPERATIVE (Non-distributing cooperative)
- NON_GOVERNMENT_SCHOOL (Non-government school)
- NON_PROFIT_ORGANISATION (Non-profit organisation)
- NON_TRADING_COOPERATIVE (Non-trading cooperative)
- NOT_FOR_PROFIT_COMMUNITY_GROUP (Not-for-profit community group)
- PARTNERSHIP (Partnership)
- PEAK_STATE_TERRITORY_BODY (Peak state/territory body)
- PENDING_TM_OWNER (Pending TM owner)
- POLITICAL_PARTY (Political party)
- PRESCHOOL (Pre-school)
- PUBLIC_PRIVATE_ANCILLARY_FUND (Public/private ancillary fund)
- REGISTERED_BUSINESS (Registered business)
- REGISTERED_ORGANISATION (Registered organisation)
- REGISTRABLE_BODY (Registrable body)
- RESEARCH_ORGANISATION (Research organisation)
- STATUTORY_BODY (Statutory body)
- TRADE_UNION (Trade union)
- TRADEMARK_OWNER (Trademark owner)
- TRADING_COOPERATIVE (Trading cooperative)
- TRAINING_ORGANISATION (Training organisation)
- TRUST (Trust)
- UNINCORPORATED_ASSOCIATION (Unincorporated association)
- EDUCATION_AND_CARE_SERVICES_CHILDCARE (Education and care services (child care))
- GOVERNMENT_BODY (Government body)
- PROVIDER_OF_NON_ACCREDITED_TRAINING (Provider of non-accredited training)
- RELIGIOUS_CHURCH_GROUP (Religious/church group)
- SOLE_TRADER (Sole trader)
AU_POLICY_REASONValid values include the following:
POLICY_REASON_1POLICY_REASON_2.ca
BRAND_NUMBER
CA_BUSINESS_ENTITY_TYPEValid values include the following:
BANK(Bank)COMMERCIAL_COMPANY(Commercial company)COMPANY(Company)COOPERATION(Cooperation)COOPERATIVE(Cooperative)COOPRIX(Cooprix)CORP(Corporation)CREDIT_UNION(Credit union)FOMIA(Federation of mutual insurance associations)INC(Incorporated)LTD(Limited)LTEE(Limitée)LLC(Limited liability corporation)LLP(Limited liability partnership)LTE(Lte.)MBA(Mutual benefit association)MIC(Mutual insurance company)NFP(Not-for-profit corporation)SA(S.A.)SAVINGS_COMPANY(Savings company)SAVINGS_UNION(Savings union)SARL(Société à responsabilité limitée)TRUST(Trust)ULC(Unlimited liability corporation)
CA_LEGAL_TYPEWhenContactTypeisPERSON, valid values include the following:
ABO(Aboriginal Peoples indigenous to Canada)CCT(Canadian citizen)LGR(Legal Representative of a Canadian Citizen or Permanent Resident)RES(Permanent resident of Canada)When
ContactTypeis a value other thanPERSON, valid values include the following:
ASS(Canadian unincorporated association)CCO(Canadian corporation)EDU(Canadian educational institution)GOV(Government or government entity in Canada)HOP(Canadian Hospital)INB(Indian Band recognized by the Indian Act of Canada)LAM(Canadian Library, Archive, or Museum)MAJ(Her/His Majesty the Queen/King)OMK(Official mark registered in Canada)PLT(Canadian Political Party)PRT(Partnership Registered in Canada)TDM(Trademark registered in Canada)TRD(Canadian Trade Union)TRS(Trust established in Canada).es
ES_IDENTIFICATIONThe value ofES_IDENTIFICATIONdepends on the following values:
- The value of
ES_LEGAL_FORM- The value of
ES_IDENTIFICATION_TYPEIf ``ES_LEGAL_FORM`` is any value other than ``INDIVIDUAL`` :
- Specify 1 letter + 8 numbers (CIF [Certificado de Identificación Fiscal])
- Example: B12345678
If ``ES_LEGAL_FORM`` is ``INDIVIDUAL`` , the value that you specify for ``ES_IDENTIFICATION`` depends on the value of ``ES_IDENTIFICATION_TYPE`` :
- If
ES_IDENTIFICATION_TYPEisDNI_AND_NIF(for Spanish contacts):
- Specify 8 numbers + 1 letter (DNI [Documento Nacional de Identidad], NIF [Número de Identificación Fiscal])
- Example: 12345678M
- If
ES_IDENTIFICATION_TYPEisNIE(for foreigners with legal residence):
- Specify 1 letter + 7 numbers + 1 letter ( NIE [Número de Identidad de Extranjero])
- Example: Y1234567X
- If
ES_IDENTIFICATION_TYPEisOTHER(for contacts outside of Spain):
- Specify a passport number, drivers license number, or national identity card number
ES_IDENTIFICATION_TYPEValid values include the following:
DNI_AND_NIF(For Spanish contacts)NIE(For foreigners with legal residence)OTHER(For contacts outside of Spain)
ES_LEGAL_FORMValid values include the following:
ASSOCIATIONCENTRAL_GOVERNMENT_BODYCIVIL_SOCIETYCOMMUNITY_OF_OWNERSCOMMUNITY_PROPERTYCONSULATECOOPERATIVEDESIGNATION_OF_ORIGIN_SUPERVISORY_COUNCILECONOMIC_INTEREST_GROUPEMBASSYENTITY_MANAGING_NATURAL_AREASFARM_PARTNERSHIPFOUNDATIONGENERAL_AND_LIMITED_PARTNERSHIPGENERAL_PARTNERSHIPINDIVIDUALLIMITED_COMPANYLOCAL_AUTHORITYLOCAL_PUBLIC_ENTITYMUTUAL_INSURANCE_COMPANYNATIONAL_PUBLIC_ENTITYORDER_OR_RELIGIOUS_INSTITUTIONOTHERS (Only for contacts outside of Spain)POLITICAL_PARTYPROFESSIONAL_ASSOCIATIONPUBLIC_LAW_ASSOCIATIONPUBLIC_LIMITED_COMPANYREGIONAL_GOVERNMENT_BODYREGIONAL_PUBLIC_ENTITYSAVINGS_BANKSPANISH_OFFICESPORTS_ASSOCIATIONSPORTS_FEDERATIONSPORTS_LIMITED_COMPANYTEMPORARY_ALLIANCE_OF_ENTERPRISESTRADE_UNIONWORKER_OWNED_COMPANYWORKER_OWNED_LIMITED_COMPANY.eu
EU_COUNTRY_OF_CITIZENSHIP.fi
BIRTH_DATE_IN_YYYY_MM_DD
FI_BUSINESS_NUMBER
FI_ID_NUMBER
FI_NATIONALITYValid values include the following:
FINNISHNOT_FINNISH
FI_ORGANIZATION_TYPEValid values include the following:
COMPANYCORPORATIONGOVERNMENTINSTITUTIONPOLITICAL_PARTYPUBLIC_COMMUNITYTOWNSHIP.it
IT_NATIONALITY
IT_PIN
IT_REGISTRANT_ENTITY_TYPEValid values include the following:
FOREIGNERSFREELANCE_WORKERS(Freelance workers and professionals)ITALIAN_COMPANIES(Italian companies and one-person companies)NON_PROFIT_ORGANIZATIONSOTHER_SUBJECTSPUBLIC_ORGANIZATIONS.ru
BIRTH_DATE_IN_YYYY_MM_DD
RU_PASSPORT_DATA.se
BIRTH_COUNTRY
SE_ID_NUMBER.sg
SG_ID_NUMBER.uk, .co.uk, .me.uk, and .org.uk
UK_CONTACT_TYPEValid values include the following:
CRC(UK Corporation by Royal Charter)FCORP(Non-UK Corporation)FIND(Non-UK Individual, representing self)FOTHER(Non-UK Entity that does not fit into any other category)GOV(UK Government Body)IND(UK Individual (representing self))IP(UK Industrial/Provident Registered Company)LLP(UK Limited Liability Partnership)LTD(UK Limited Company)OTHER(UK Entity that does not fit into any other category)PLC(UK Public Limited Company)PTNR(UK Partnership)RCHAR(UK Registered Charity)SCH(UK School)STAT(UK Statutory Body)STRA(UK Sole Trader)
UK_COMPANY_NUMBERIn addition, many TLDs require a
VAT_NUMBER.Possible values:
DUNS_NUMBERBRAND_NUMBERBIRTH_DEPARTMENTBIRTH_DATE_IN_YYYY_MM_DDBIRTH_COUNTRYBIRTH_CITYDOCUMENT_NUMBERAU_ID_NUMBERAU_ID_TYPECA_LEGAL_TYPECA_BUSINESS_ENTITY_TYPECA_LEGAL_REPRESENTATIVECA_LEGAL_REPRESENTATIVE_CAPACITYES_IDENTIFICATIONES_IDENTIFICATION_TYPEES_LEGAL_FORMFI_BUSINESS_NUMBERFI_ID_NUMBERFI_NATIONALITYFI_ORGANIZATION_TYPEIT_NATIONALITYIT_PINIT_REGISTRANT_ENTITY_TYPERU_PASSPORT_DATASE_ID_NUMBERSG_ID_NUMBERVAT_NUMBERUK_CONTACT_TYPEUK_COMPANY_NUMBEREU_COUNTRY_OF_CITIZENSHIPAU_PRIORITY_TOKENAU_ELIGIBILITY_TYPEAU_POLICY_REASONAU_REGISTRANT_NAMEValue -> (string) [required]
The value that corresponds with the name of an extra parameter.
Constraints:
- max:
2048
RegistrantContact -> (structure)
Provides details about the domain registrant.
FirstName -> (string)
First name of contact.
Constraints:
- max:
255LastName -> (string)
Last name of contact.
Constraints:
- max:
255ContactType -> (string)
Indicates whether the contact is a person, company, association, or public organization. Note the following:
- If you specify a value other than
PERSON, you must also specify a value forOrganizationName.- For some TLDs, the privacy protection available depends on the value that you specify for
Contact Type. For the privacy protection settings for your TLD, see Domains that You Can Register with Amazon Route 53 in the Amazon Route 53 Developer Guide- For .es domains, the value of
ContactTypemust bePERSONfor all three contacts.Possible values:
PERSONCOMPANYASSOCIATIONPUBLIC_BODYRESELLEROrganizationName -> (string)
Name of the organization for contact types other than
PERSON.Constraints:
- max:
255AddressLine1 -> (string)
First line of the contact’s address.
Constraints:
- max:
255AddressLine2 -> (string)
Second line of contact’s address, if any.
Constraints:
- max:
255City -> (string)
The city of the contact’s address.
Constraints:
- max:
255State -> (string)
The state or province of the contact’s city.
Constraints:
- max:
255CountryCode -> (string)
Code for the country of the contact’s address.
Possible values:
ACADAEAFAGAIALAMANAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTPTRTTTVTWTZUAUGUSUYUZVAVCVEVGVIVNVUWFWSYEYTZAZMZWZipCode -> (string)
The zip or postal code of the contact’s address.
Constraints:
- max:
255PhoneNumber -> (string)
The phone number of the contact.
Constraints: Phone number must be specified in the format “+[country dialing code].[number including any area code>]”. For example, a US phone number might appear as
"+1.1234567890".Constraints:
- max:
30Email -> (string)
Email address of the contact.
Constraints:
- max:
254Fax -> (string)
Fax number of the contact.
Constraints: Phone number must be specified in the format “+[country dialing code].[number including any area code]”. For example, a US phone number might appear as
"+1.1234567890".Constraints:
- max:
30ExtraParams -> (list)
A list of name-value pairs for parameters required by certain top-level domains.
(structure)
ExtraParam includes the following elements.
Name -> (string) [required]
The name of an additional parameter that is required by a top-level domain. Here are the top-level domains that require additional parameters and the names of the parameters that they require:
.au, .com.au, and .net.au
AU_REGISTRANT_NAME
AU_ID_NUMBER
AU_ID_TYPEValid values include the following:
ABN(Australian business number)ACN(Australian company number)TM(Trademark number)
AU_ELIGIBILITY_TYPEValid values include the following:
- CHARITABLE_TRUST (Charitable trust)
- CHARITY (Charity)
- CHILD_CARE_CENTRE (Child care centre)
- CLUB (Club)
- COMMERCIAL_STATUTORY_BODY (Commercial statutory body)
- COMMONWEALTH_ENTITY (Commonwealth entity)
- COMPANY (Company)
- COMPANY_LIMITED_BY_GUARANTEE (Company limited by guarantee)
- EDUCATIONAL_INSTITUTION (Educational institution)
- GOVERNMENT_SCHOOL (Government school)
- HIGHER_EDUCATION_INSTITUTION (Higher education institution)
- INCORPORATED_ASSOCIATION (Incorporated association)
- INDIGENOUS_CORPORATION (Indigenous corporation)
- INDUSTRY_BODY (Industry body)
- INDUSTRY_ORGANISATION (Industry association)
- NATIONAL_BODY (National body)
- NON_DISTRIBUTING_COOPERATIVE (Non-distributing cooperative)
- NON_GOVERNMENT_SCHOOL (Non-government school)
- NON_PROFIT_ORGANISATION (Non-profit organisation)
- NON_TRADING_COOPERATIVE (Non-trading cooperative)
- NOT_FOR_PROFIT_COMMUNITY_GROUP (Not-for-profit community group)
- PARTNERSHIP (Partnership)
- PEAK_STATE_TERRITORY_BODY (Peak state/territory body)
- PENDING_TM_OWNER (Pending TM owner)
- POLITICAL_PARTY (Political party)
- PRESCHOOL (Pre-school)
- PUBLIC_PRIVATE_ANCILLARY_FUND (Public/private ancillary fund)
- REGISTERED_BUSINESS (Registered business)
- REGISTERED_ORGANISATION (Registered organisation)
- REGISTRABLE_BODY (Registrable body)
- RESEARCH_ORGANISATION (Research organisation)
- STATUTORY_BODY (Statutory body)
- TRADE_UNION (Trade union)
- TRADEMARK_OWNER (Trademark owner)
- TRADING_COOPERATIVE (Trading cooperative)
- TRAINING_ORGANISATION (Training organisation)
- TRUST (Trust)
- UNINCORPORATED_ASSOCIATION (Unincorporated association)
- EDUCATION_AND_CARE_SERVICES_CHILDCARE (Education and care services (child care))
- GOVERNMENT_BODY (Government body)
- PROVIDER_OF_NON_ACCREDITED_TRAINING (Provider of non-accredited training)
- RELIGIOUS_CHURCH_GROUP (Religious/church group)
- SOLE_TRADER (Sole trader)
AU_POLICY_REASONValid values include the following:
POLICY_REASON_1POLICY_REASON_2.ca
BRAND_NUMBER
CA_BUSINESS_ENTITY_TYPEValid values include the following:
BANK(Bank)COMMERCIAL_COMPANY(Commercial company)COMPANY(Company)COOPERATION(Cooperation)COOPERATIVE(Cooperative)COOPRIX(Cooprix)CORP(Corporation)CREDIT_UNION(Credit union)FOMIA(Federation of mutual insurance associations)INC(Incorporated)LTD(Limited)LTEE(Limitée)LLC(Limited liability corporation)LLP(Limited liability partnership)LTE(Lte.)MBA(Mutual benefit association)MIC(Mutual insurance company)NFP(Not-for-profit corporation)SA(S.A.)SAVINGS_COMPANY(Savings company)SAVINGS_UNION(Savings union)SARL(Société à responsabilité limitée)TRUST(Trust)ULC(Unlimited liability corporation)
CA_LEGAL_TYPEWhenContactTypeisPERSON, valid values include the following:
ABO(Aboriginal Peoples indigenous to Canada)CCT(Canadian citizen)LGR(Legal Representative of a Canadian Citizen or Permanent Resident)RES(Permanent resident of Canada)When
ContactTypeis a value other thanPERSON, valid values include the following:
ASS(Canadian unincorporated association)CCO(Canadian corporation)EDU(Canadian educational institution)GOV(Government or government entity in Canada)HOP(Canadian Hospital)INB(Indian Band recognized by the Indian Act of Canada)LAM(Canadian Library, Archive, or Museum)MAJ(Her/His Majesty the Queen/King)OMK(Official mark registered in Canada)PLT(Canadian Political Party)PRT(Partnership Registered in Canada)TDM(Trademark registered in Canada)TRD(Canadian Trade Union)TRS(Trust established in Canada).es
ES_IDENTIFICATIONThe value ofES_IDENTIFICATIONdepends on the following values:
- The value of
ES_LEGAL_FORM- The value of
ES_IDENTIFICATION_TYPEIf ``ES_LEGAL_FORM`` is any value other than ``INDIVIDUAL`` :
- Specify 1 letter + 8 numbers (CIF [Certificado de Identificación Fiscal])
- Example: B12345678
If ``ES_LEGAL_FORM`` is ``INDIVIDUAL`` , the value that you specify for ``ES_IDENTIFICATION`` depends on the value of ``ES_IDENTIFICATION_TYPE`` :
- If
ES_IDENTIFICATION_TYPEisDNI_AND_NIF(for Spanish contacts):
- Specify 8 numbers + 1 letter (DNI [Documento Nacional de Identidad], NIF [Número de Identificación Fiscal])
- Example: 12345678M
- If
ES_IDENTIFICATION_TYPEisNIE(for foreigners with legal residence):
- Specify 1 letter + 7 numbers + 1 letter ( NIE [Número de Identidad de Extranjero])
- Example: Y1234567X
- If
ES_IDENTIFICATION_TYPEisOTHER(for contacts outside of Spain):
- Specify a passport number, drivers license number, or national identity card number
ES_IDENTIFICATION_TYPEValid values include the following:
DNI_AND_NIF(For Spanish contacts)NIE(For foreigners with legal residence)OTHER(For contacts outside of Spain)
ES_LEGAL_FORMValid values include the following:
ASSOCIATIONCENTRAL_GOVERNMENT_BODYCIVIL_SOCIETYCOMMUNITY_OF_OWNERSCOMMUNITY_PROPERTYCONSULATECOOPERATIVEDESIGNATION_OF_ORIGIN_SUPERVISORY_COUNCILECONOMIC_INTEREST_GROUPEMBASSYENTITY_MANAGING_NATURAL_AREASFARM_PARTNERSHIPFOUNDATIONGENERAL_AND_LIMITED_PARTNERSHIPGENERAL_PARTNERSHIPINDIVIDUALLIMITED_COMPANYLOCAL_AUTHORITYLOCAL_PUBLIC_ENTITYMUTUAL_INSURANCE_COMPANYNATIONAL_PUBLIC_ENTITYORDER_OR_RELIGIOUS_INSTITUTIONOTHERS (Only for contacts outside of Spain)POLITICAL_PARTYPROFESSIONAL_ASSOCIATIONPUBLIC_LAW_ASSOCIATIONPUBLIC_LIMITED_COMPANYREGIONAL_GOVERNMENT_BODYREGIONAL_PUBLIC_ENTITYSAVINGS_BANKSPANISH_OFFICESPORTS_ASSOCIATIONSPORTS_FEDERATIONSPORTS_LIMITED_COMPANYTEMPORARY_ALLIANCE_OF_ENTERPRISESTRADE_UNIONWORKER_OWNED_COMPANYWORKER_OWNED_LIMITED_COMPANY.eu
EU_COUNTRY_OF_CITIZENSHIP.fi
BIRTH_DATE_IN_YYYY_MM_DD
FI_BUSINESS_NUMBER
FI_ID_NUMBER
FI_NATIONALITYValid values include the following:
FINNISHNOT_FINNISH
FI_ORGANIZATION_TYPEValid values include the following:
COMPANYCORPORATIONGOVERNMENTINSTITUTIONPOLITICAL_PARTYPUBLIC_COMMUNITYTOWNSHIP.it
IT_NATIONALITY
IT_PIN
IT_REGISTRANT_ENTITY_TYPEValid values include the following:
FOREIGNERSFREELANCE_WORKERS(Freelance workers and professionals)ITALIAN_COMPANIES(Italian companies and one-person companies)NON_PROFIT_ORGANIZATIONSOTHER_SUBJECTSPUBLIC_ORGANIZATIONS.ru
BIRTH_DATE_IN_YYYY_MM_DD
RU_PASSPORT_DATA.se
BIRTH_COUNTRY
SE_ID_NUMBER.sg
SG_ID_NUMBER.uk, .co.uk, .me.uk, and .org.uk
UK_CONTACT_TYPEValid values include the following:
CRC(UK Corporation by Royal Charter)FCORP(Non-UK Corporation)FIND(Non-UK Individual, representing self)FOTHER(Non-UK Entity that does not fit into any other category)GOV(UK Government Body)IND(UK Individual (representing self))IP(UK Industrial/Provident Registered Company)LLP(UK Limited Liability Partnership)LTD(UK Limited Company)OTHER(UK Entity that does not fit into any other category)PLC(UK Public Limited Company)PTNR(UK Partnership)RCHAR(UK Registered Charity)SCH(UK School)STAT(UK Statutory Body)STRA(UK Sole Trader)
UK_COMPANY_NUMBERIn addition, many TLDs require a
VAT_NUMBER.Possible values:
DUNS_NUMBERBRAND_NUMBERBIRTH_DEPARTMENTBIRTH_DATE_IN_YYYY_MM_DDBIRTH_COUNTRYBIRTH_CITYDOCUMENT_NUMBERAU_ID_NUMBERAU_ID_TYPECA_LEGAL_TYPECA_BUSINESS_ENTITY_TYPECA_LEGAL_REPRESENTATIVECA_LEGAL_REPRESENTATIVE_CAPACITYES_IDENTIFICATIONES_IDENTIFICATION_TYPEES_LEGAL_FORMFI_BUSINESS_NUMBERFI_ID_NUMBERFI_NATIONALITYFI_ORGANIZATION_TYPEIT_NATIONALITYIT_PINIT_REGISTRANT_ENTITY_TYPERU_PASSPORT_DATASE_ID_NUMBERSG_ID_NUMBERVAT_NUMBERUK_CONTACT_TYPEUK_COMPANY_NUMBEREU_COUNTRY_OF_CITIZENSHIPAU_PRIORITY_TOKENAU_ELIGIBILITY_TYPEAU_POLICY_REASONAU_REGISTRANT_NAMEValue -> (string) [required]
The value that corresponds with the name of an extra parameter.
Constraints:
- max:
2048
TechContact -> (structure)
Provides details about the domain technical contact.
FirstName -> (string)
First name of contact.
Constraints:
- max:
255LastName -> (string)
Last name of contact.
Constraints:
- max:
255ContactType -> (string)
Indicates whether the contact is a person, company, association, or public organization. Note the following:
- If you specify a value other than
PERSON, you must also specify a value forOrganizationName.- For some TLDs, the privacy protection available depends on the value that you specify for
Contact Type. For the privacy protection settings for your TLD, see Domains that You Can Register with Amazon Route 53 in the Amazon Route 53 Developer Guide- For .es domains, the value of
ContactTypemust bePERSONfor all three contacts.Possible values:
PERSONCOMPANYASSOCIATIONPUBLIC_BODYRESELLEROrganizationName -> (string)
Name of the organization for contact types other than
PERSON.Constraints:
- max:
255AddressLine1 -> (string)
First line of the contact’s address.
Constraints:
- max:
255AddressLine2 -> (string)
Second line of contact’s address, if any.
Constraints:
- max:
255City -> (string)
The city of the contact’s address.
Constraints:
- max:
255State -> (string)
The state or province of the contact’s city.
Constraints:
- max:
255CountryCode -> (string)
Code for the country of the contact’s address.
Possible values:
ACADAEAFAGAIALAMANAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTPTRTTTVTWTZUAUGUSUYUZVAVCVEVGVIVNVUWFWSYEYTZAZMZWZipCode -> (string)
The zip or postal code of the contact’s address.
Constraints:
- max:
255PhoneNumber -> (string)
The phone number of the contact.
Constraints: Phone number must be specified in the format “+[country dialing code].[number including any area code>]”. For example, a US phone number might appear as
"+1.1234567890".Constraints:
- max:
30Email -> (string)
Email address of the contact.
Constraints:
- max:
254Fax -> (string)
Fax number of the contact.
Constraints: Phone number must be specified in the format “+[country dialing code].[number including any area code]”. For example, a US phone number might appear as
"+1.1234567890".Constraints:
- max:
30ExtraParams -> (list)
A list of name-value pairs for parameters required by certain top-level domains.
(structure)
ExtraParam includes the following elements.
Name -> (string) [required]
The name of an additional parameter that is required by a top-level domain. Here are the top-level domains that require additional parameters and the names of the parameters that they require:
.au, .com.au, and .net.au
AU_REGISTRANT_NAME
AU_ID_NUMBER
AU_ID_TYPEValid values include the following:
ABN(Australian business number)ACN(Australian company number)TM(Trademark number)
AU_ELIGIBILITY_TYPEValid values include the following:
- CHARITABLE_TRUST (Charitable trust)
- CHARITY (Charity)
- CHILD_CARE_CENTRE (Child care centre)
- CLUB (Club)
- COMMERCIAL_STATUTORY_BODY (Commercial statutory body)
- COMMONWEALTH_ENTITY (Commonwealth entity)
- COMPANY (Company)
- COMPANY_LIMITED_BY_GUARANTEE (Company limited by guarantee)
- EDUCATIONAL_INSTITUTION (Educational institution)
- GOVERNMENT_SCHOOL (Government school)
- HIGHER_EDUCATION_INSTITUTION (Higher education institution)
- INCORPORATED_ASSOCIATION (Incorporated association)
- INDIGENOUS_CORPORATION (Indigenous corporation)
- INDUSTRY_BODY (Industry body)
- INDUSTRY_ORGANISATION (Industry association)
- NATIONAL_BODY (National body)
- NON_DISTRIBUTING_COOPERATIVE (Non-distributing cooperative)
- NON_GOVERNMENT_SCHOOL (Non-government school)
- NON_PROFIT_ORGANISATION (Non-profit organisation)
- NON_TRADING_COOPERATIVE (Non-trading cooperative)
- NOT_FOR_PROFIT_COMMUNITY_GROUP (Not-for-profit community group)
- PARTNERSHIP (Partnership)
- PEAK_STATE_TERRITORY_BODY (Peak state/territory body)
- PENDING_TM_OWNER (Pending TM owner)
- POLITICAL_PARTY (Political party)
- PRESCHOOL (Pre-school)
- PUBLIC_PRIVATE_ANCILLARY_FUND (Public/private ancillary fund)
- REGISTERED_BUSINESS (Registered business)
- REGISTERED_ORGANISATION (Registered organisation)
- REGISTRABLE_BODY (Registrable body)
- RESEARCH_ORGANISATION (Research organisation)
- STATUTORY_BODY (Statutory body)
- TRADE_UNION (Trade union)
- TRADEMARK_OWNER (Trademark owner)
- TRADING_COOPERATIVE (Trading cooperative)
- TRAINING_ORGANISATION (Training organisation)
- TRUST (Trust)
- UNINCORPORATED_ASSOCIATION (Unincorporated association)
- EDUCATION_AND_CARE_SERVICES_CHILDCARE (Education and care services (child care))
- GOVERNMENT_BODY (Government body)
- PROVIDER_OF_NON_ACCREDITED_TRAINING (Provider of non-accredited training)
- RELIGIOUS_CHURCH_GROUP (Religious/church group)
- SOLE_TRADER (Sole trader)
AU_POLICY_REASONValid values include the following:
POLICY_REASON_1POLICY_REASON_2.ca
BRAND_NUMBER
CA_BUSINESS_ENTITY_TYPEValid values include the following:
BANK(Bank)COMMERCIAL_COMPANY(Commercial company)COMPANY(Company)COOPERATION(Cooperation)COOPERATIVE(Cooperative)COOPRIX(Cooprix)CORP(Corporation)CREDIT_UNION(Credit union)FOMIA(Federation of mutual insurance associations)INC(Incorporated)LTD(Limited)LTEE(Limitée)LLC(Limited liability corporation)LLP(Limited liability partnership)LTE(Lte.)MBA(Mutual benefit association)MIC(Mutual insurance company)NFP(Not-for-profit corporation)SA(S.A.)SAVINGS_COMPANY(Savings company)SAVINGS_UNION(Savings union)SARL(Société à responsabilité limitée)TRUST(Trust)ULC(Unlimited liability corporation)
CA_LEGAL_TYPEWhenContactTypeisPERSON, valid values include the following:
ABO(Aboriginal Peoples indigenous to Canada)CCT(Canadian citizen)LGR(Legal Representative of a Canadian Citizen or Permanent Resident)RES(Permanent resident of Canada)When
ContactTypeis a value other thanPERSON, valid values include the following:
ASS(Canadian unincorporated association)CCO(Canadian corporation)EDU(Canadian educational institution)GOV(Government or government entity in Canada)HOP(Canadian Hospital)INB(Indian Band recognized by the Indian Act of Canada)LAM(Canadian Library, Archive, or Museum)MAJ(Her/His Majesty the Queen/King)OMK(Official mark registered in Canada)PLT(Canadian Political Party)PRT(Partnership Registered in Canada)TDM(Trademark registered in Canada)TRD(Canadian Trade Union)TRS(Trust established in Canada).es
ES_IDENTIFICATIONThe value ofES_IDENTIFICATIONdepends on the following values:
- The value of
ES_LEGAL_FORM- The value of
ES_IDENTIFICATION_TYPEIf ``ES_LEGAL_FORM`` is any value other than ``INDIVIDUAL`` :
- Specify 1 letter + 8 numbers (CIF [Certificado de Identificación Fiscal])
- Example: B12345678
If ``ES_LEGAL_FORM`` is ``INDIVIDUAL`` , the value that you specify for ``ES_IDENTIFICATION`` depends on the value of ``ES_IDENTIFICATION_TYPE`` :
- If
ES_IDENTIFICATION_TYPEisDNI_AND_NIF(for Spanish contacts):
- Specify 8 numbers + 1 letter (DNI [Documento Nacional de Identidad], NIF [Número de Identificación Fiscal])
- Example: 12345678M
- If
ES_IDENTIFICATION_TYPEisNIE(for foreigners with legal residence):
- Specify 1 letter + 7 numbers + 1 letter ( NIE [Número de Identidad de Extranjero])
- Example: Y1234567X
- If
ES_IDENTIFICATION_TYPEisOTHER(for contacts outside of Spain):
- Specify a passport number, drivers license number, or national identity card number
ES_IDENTIFICATION_TYPEValid values include the following:
DNI_AND_NIF(For Spanish contacts)NIE(For foreigners with legal residence)OTHER(For contacts outside of Spain)
ES_LEGAL_FORMValid values include the following:
ASSOCIATIONCENTRAL_GOVERNMENT_BODYCIVIL_SOCIETYCOMMUNITY_OF_OWNERSCOMMUNITY_PROPERTYCONSULATECOOPERATIVEDESIGNATION_OF_ORIGIN_SUPERVISORY_COUNCILECONOMIC_INTEREST_GROUPEMBASSYENTITY_MANAGING_NATURAL_AREASFARM_PARTNERSHIPFOUNDATIONGENERAL_AND_LIMITED_PARTNERSHIPGENERAL_PARTNERSHIPINDIVIDUALLIMITED_COMPANYLOCAL_AUTHORITYLOCAL_PUBLIC_ENTITYMUTUAL_INSURANCE_COMPANYNATIONAL_PUBLIC_ENTITYORDER_OR_RELIGIOUS_INSTITUTIONOTHERS (Only for contacts outside of Spain)POLITICAL_PARTYPROFESSIONAL_ASSOCIATIONPUBLIC_LAW_ASSOCIATIONPUBLIC_LIMITED_COMPANYREGIONAL_GOVERNMENT_BODYREGIONAL_PUBLIC_ENTITYSAVINGS_BANKSPANISH_OFFICESPORTS_ASSOCIATIONSPORTS_FEDERATIONSPORTS_LIMITED_COMPANYTEMPORARY_ALLIANCE_OF_ENTERPRISESTRADE_UNIONWORKER_OWNED_COMPANYWORKER_OWNED_LIMITED_COMPANY.eu
EU_COUNTRY_OF_CITIZENSHIP.fi
BIRTH_DATE_IN_YYYY_MM_DD
FI_BUSINESS_NUMBER
FI_ID_NUMBER
FI_NATIONALITYValid values include the following:
FINNISHNOT_FINNISH
FI_ORGANIZATION_TYPEValid values include the following:
COMPANYCORPORATIONGOVERNMENTINSTITUTIONPOLITICAL_PARTYPUBLIC_COMMUNITYTOWNSHIP.it
IT_NATIONALITY
IT_PIN
IT_REGISTRANT_ENTITY_TYPEValid values include the following:
FOREIGNERSFREELANCE_WORKERS(Freelance workers and professionals)ITALIAN_COMPANIES(Italian companies and one-person companies)NON_PROFIT_ORGANIZATIONSOTHER_SUBJECTSPUBLIC_ORGANIZATIONS.ru
BIRTH_DATE_IN_YYYY_MM_DD
RU_PASSPORT_DATA.se
BIRTH_COUNTRY
SE_ID_NUMBER.sg
SG_ID_NUMBER.uk, .co.uk, .me.uk, and .org.uk
UK_CONTACT_TYPEValid values include the following:
CRC(UK Corporation by Royal Charter)FCORP(Non-UK Corporation)FIND(Non-UK Individual, representing self)FOTHER(Non-UK Entity that does not fit into any other category)GOV(UK Government Body)IND(UK Individual (representing self))IP(UK Industrial/Provident Registered Company)LLP(UK Limited Liability Partnership)LTD(UK Limited Company)OTHER(UK Entity that does not fit into any other category)PLC(UK Public Limited Company)PTNR(UK Partnership)RCHAR(UK Registered Charity)SCH(UK School)STAT(UK Statutory Body)STRA(UK Sole Trader)
UK_COMPANY_NUMBERIn addition, many TLDs require a
VAT_NUMBER.Possible values:
DUNS_NUMBERBRAND_NUMBERBIRTH_DEPARTMENTBIRTH_DATE_IN_YYYY_MM_DDBIRTH_COUNTRYBIRTH_CITYDOCUMENT_NUMBERAU_ID_NUMBERAU_ID_TYPECA_LEGAL_TYPECA_BUSINESS_ENTITY_TYPECA_LEGAL_REPRESENTATIVECA_LEGAL_REPRESENTATIVE_CAPACITYES_IDENTIFICATIONES_IDENTIFICATION_TYPEES_LEGAL_FORMFI_BUSINESS_NUMBERFI_ID_NUMBERFI_NATIONALITYFI_ORGANIZATION_TYPEIT_NATIONALITYIT_PINIT_REGISTRANT_ENTITY_TYPERU_PASSPORT_DATASE_ID_NUMBERSG_ID_NUMBERVAT_NUMBERUK_CONTACT_TYPEUK_COMPANY_NUMBEREU_COUNTRY_OF_CITIZENSHIPAU_PRIORITY_TOKENAU_ELIGIBILITY_TYPEAU_POLICY_REASONAU_REGISTRANT_NAMEValue -> (string) [required]
The value that corresponds with the name of an extra parameter.
Constraints:
- max:
2048
AdminPrivacy -> (boolean)
Specifies whether contact information is concealed from WHOIS queries. If the value istrue, WHOIS (“who is”) queries return contact information either for Amazon Registrar or for our registrar associate, Gandi. If the value isfalse, WHOIS queries return the information that you entered for the admin contact.
RegistrantPrivacy -> (boolean)
Specifies whether contact information is concealed from WHOIS queries. If the value istrue, WHOIS (“who is”) queries return contact information either for Amazon Registrar or for our registrar associate, Gandi. If the value isfalse, WHOIS queries return the information that you entered for the registrant contact (domain owner).
TechPrivacy -> (boolean)
Specifies whether contact information is concealed from WHOIS queries. If the value istrue, WHOIS (“who is”) queries return contact information either for Amazon Registrar or for our registrar associate, Gandi. If the value isfalse, WHOIS queries return the information that you entered for the technical contact.
RegistrarName -> (string)
Name of the registrar of the domain as identified in the registry.
WhoIsServer -> (string)
The fully qualified name of the WHOIS server that can answer the WHOIS query for the domain.
RegistrarUrl -> (string)
Web address of the registrar.
AbuseContactEmail -> (string)
Email address to contact to report incorrect contact information for a domain, to report that the domain is being used to send spam, to report that someone is cybersquatting on a domain name, or report some other type of abuse.
Constraints:
- max:
254
AbuseContactPhone -> (string)
Phone number for reporting abuse.
Constraints:
- max:
30
RegistryDomainId -> (string)
Reserved for future use.
CreationDate -> (timestamp)
The date when the domain was created as found in the response to a WHOIS query. The date and time is in Unix time format and Coordinated Universal time (UTC).
UpdatedDate -> (timestamp)
The last updated date of the domain as found in the response to a WHOIS query. The date and time is in Unix time format and Coordinated Universal time (UTC).
ExpirationDate -> (timestamp)
The date when the registration for the domain is set to expire. The date and time is in Unix time format and Coordinated Universal time (UTC).
Reseller -> (string)
Reserved for future use.
DnsSec -> (string)
Deprecated.
StatusList -> (list)
An array of domain name status codes, also known as Extensible Provisioning Protocol (EPP) status codes.
ICANN, the organization that maintains a central database of domain names, has developed a set of domain name status codes that tell you the status of a variety of operations on a domain name, for example, registering a domain name, transferring a domain name to another registrar, renewing the registration for a domain name, and so on. All registrars use this same set of status codes.
For a current list of domain name status codes and an explanation of what each code means, go to the ICANN website and search for
epp status codes. (Search on the ICANN website; web searches sometimes return an old version of the document.)(string)
DnssecKeys -> (list)
A complex type that contains information about the DNSSEC configuration.
(structure)
Information about the DNSSEC key.
You get this from your DNS provider and then give it to Route 53 (by using AssociateDelegationSignerToDomain ) to pass it to the registry to establish the chain of trust.
Algorithm -> (integer)
The number of the public key’s cryptographic algorithm according to an IANA assignment.
If Route 53 is your DNS service, set this to 13.
For more information about enabling DNSSEC signing, see Enabling DNSSEC signing and establishing a chain of trust .
Flags -> (integer)
Defines the type of key. It can be either a KSK (key-signing-key, value 257) or ZSK (zone-signing-key, value 256). Using KSK is always encouraged. Only use ZSK if your DNS provider isn’t Route 53 and you don’t have KSK available.
If you have KSK and ZSK keys, always use KSK to create a delegations signer (DS) record. If you have ZSK keys only – use ZSK to create a DS record.
PublicKey -> (string)
The base64-encoded public key part of the key pair that is passed to the registry .
Constraints:
- max:
32768DigestType -> (integer)
The number of the DS digest algorithm according to an IANA assignment.
For more information, see IANA for DNSSEC Delegation Signer (DS) Resource Record (RR) Type Digest Algorithms.
Digest -> (string)
The delegation signer digest.
Digest is calculated from the public key provided using specified digest algorithm and this digest is the actual value returned from the registry nameservers as the value of DS records.
KeyTag -> (integer)
A numeric identification of the DNSKEY record referred to by this DS record.Id -> (string)
An ID assigned to each DS record created by AssociateDelegationSignerToDomain .
BillingContact -> (structure)
Provides details about the domain billing contact.
FirstName -> (string)
First name of contact.
Constraints:
- max:
255LastName -> (string)
Last name of contact.
Constraints:
- max:
255ContactType -> (string)
Indicates whether the contact is a person, company, association, or public organization. Note the following:
- If you specify a value other than
PERSON, you must also specify a value forOrganizationName.- For some TLDs, the privacy protection available depends on the value that you specify for
Contact Type. For the privacy protection settings for your TLD, see Domains that You Can Register with Amazon Route 53 in the Amazon Route 53 Developer Guide- For .es domains, the value of
ContactTypemust bePERSONfor all three contacts.Possible values:
PERSONCOMPANYASSOCIATIONPUBLIC_BODYRESELLEROrganizationName -> (string)
Name of the organization for contact types other than
PERSON.Constraints:
- max:
255AddressLine1 -> (string)
First line of the contact’s address.
Constraints:
- max:
255AddressLine2 -> (string)
Second line of contact’s address, if any.
Constraints:
- max:
255City -> (string)
The city of the contact’s address.
Constraints:
- max:
255State -> (string)
The state or province of the contact’s city.
Constraints:
- max:
255CountryCode -> (string)
Code for the country of the contact’s address.
Possible values:
ACADAEAFAGAIALAMANAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTPTRTTTVTWTZUAUGUSUYUZVAVCVEVGVIVNVUWFWSYEYTZAZMZWZipCode -> (string)
The zip or postal code of the contact’s address.
Constraints:
- max:
255PhoneNumber -> (string)
The phone number of the contact.
Constraints: Phone number must be specified in the format “+[country dialing code].[number including any area code>]”. For example, a US phone number might appear as
"+1.1234567890".Constraints:
- max:
30Email -> (string)
Email address of the contact.
Constraints:
- max:
254Fax -> (string)
Fax number of the contact.
Constraints: Phone number must be specified in the format “+[country dialing code].[number including any area code]”. For example, a US phone number might appear as
"+1.1234567890".Constraints:
- max:
30ExtraParams -> (list)
A list of name-value pairs for parameters required by certain top-level domains.
(structure)
ExtraParam includes the following elements.
Name -> (string) [required]
The name of an additional parameter that is required by a top-level domain. Here are the top-level domains that require additional parameters and the names of the parameters that they require:
.au, .com.au, and .net.au
AU_REGISTRANT_NAME
AU_ID_NUMBER
AU_ID_TYPEValid values include the following:
ABN(Australian business number)ACN(Australian company number)TM(Trademark number)
AU_ELIGIBILITY_TYPEValid values include the following:
- CHARITABLE_TRUST (Charitable trust)
- CHARITY (Charity)
- CHILD_CARE_CENTRE (Child care centre)
- CLUB (Club)
- COMMERCIAL_STATUTORY_BODY (Commercial statutory body)
- COMMONWEALTH_ENTITY (Commonwealth entity)
- COMPANY (Company)
- COMPANY_LIMITED_BY_GUARANTEE (Company limited by guarantee)
- EDUCATIONAL_INSTITUTION (Educational institution)
- GOVERNMENT_SCHOOL (Government school)
- HIGHER_EDUCATION_INSTITUTION (Higher education institution)
- INCORPORATED_ASSOCIATION (Incorporated association)
- INDIGENOUS_CORPORATION (Indigenous corporation)
- INDUSTRY_BODY (Industry body)
- INDUSTRY_ORGANISATION (Industry association)
- NATIONAL_BODY (National body)
- NON_DISTRIBUTING_COOPERATIVE (Non-distributing cooperative)
- NON_GOVERNMENT_SCHOOL (Non-government school)
- NON_PROFIT_ORGANISATION (Non-profit organisation)
- NON_TRADING_COOPERATIVE (Non-trading cooperative)
- NOT_FOR_PROFIT_COMMUNITY_GROUP (Not-for-profit community group)
- PARTNERSHIP (Partnership)
- PEAK_STATE_TERRITORY_BODY (Peak state/territory body)
- PENDING_TM_OWNER (Pending TM owner)
- POLITICAL_PARTY (Political party)
- PRESCHOOL (Pre-school)
- PUBLIC_PRIVATE_ANCILLARY_FUND (Public/private ancillary fund)
- REGISTERED_BUSINESS (Registered business)
- REGISTERED_ORGANISATION (Registered organisation)
- REGISTRABLE_BODY (Registrable body)
- RESEARCH_ORGANISATION (Research organisation)
- STATUTORY_BODY (Statutory body)
- TRADE_UNION (Trade union)
- TRADEMARK_OWNER (Trademark owner)
- TRADING_COOPERATIVE (Trading cooperative)
- TRAINING_ORGANISATION (Training organisation)
- TRUST (Trust)
- UNINCORPORATED_ASSOCIATION (Unincorporated association)
- EDUCATION_AND_CARE_SERVICES_CHILDCARE (Education and care services (child care))
- GOVERNMENT_BODY (Government body)
- PROVIDER_OF_NON_ACCREDITED_TRAINING (Provider of non-accredited training)
- RELIGIOUS_CHURCH_GROUP (Religious/church group)
- SOLE_TRADER (Sole trader)
AU_POLICY_REASONValid values include the following:
POLICY_REASON_1POLICY_REASON_2.ca
BRAND_NUMBER
CA_BUSINESS_ENTITY_TYPEValid values include the following:
BANK(Bank)COMMERCIAL_COMPANY(Commercial company)COMPANY(Company)COOPERATION(Cooperation)COOPERATIVE(Cooperative)COOPRIX(Cooprix)CORP(Corporation)CREDIT_UNION(Credit union)FOMIA(Federation of mutual insurance associations)INC(Incorporated)LTD(Limited)LTEE(Limitée)LLC(Limited liability corporation)LLP(Limited liability partnership)LTE(Lte.)MBA(Mutual benefit association)MIC(Mutual insurance company)NFP(Not-for-profit corporation)SA(S.A.)SAVINGS_COMPANY(Savings company)SAVINGS_UNION(Savings union)SARL(Société à responsabilité limitée)TRUST(Trust)ULC(Unlimited liability corporation)
CA_LEGAL_TYPEWhenContactTypeisPERSON, valid values include the following:
ABO(Aboriginal Peoples indigenous to Canada)CCT(Canadian citizen)LGR(Legal Representative of a Canadian Citizen or Permanent Resident)RES(Permanent resident of Canada)When
ContactTypeis a value other thanPERSON, valid values include the following:
ASS(Canadian unincorporated association)CCO(Canadian corporation)EDU(Canadian educational institution)GOV(Government or government entity in Canada)HOP(Canadian Hospital)INB(Indian Band recognized by the Indian Act of Canada)LAM(Canadian Library, Archive, or Museum)MAJ(Her/His Majesty the Queen/King)OMK(Official mark registered in Canada)PLT(Canadian Political Party)PRT(Partnership Registered in Canada)TDM(Trademark registered in Canada)TRD(Canadian Trade Union)TRS(Trust established in Canada).es
ES_IDENTIFICATIONThe value ofES_IDENTIFICATIONdepends on the following values:
- The value of
ES_LEGAL_FORM- The value of
ES_IDENTIFICATION_TYPEIf ``ES_LEGAL_FORM`` is any value other than ``INDIVIDUAL`` :
- Specify 1 letter + 8 numbers (CIF [Certificado de Identificación Fiscal])
- Example: B12345678
If ``ES_LEGAL_FORM`` is ``INDIVIDUAL`` , the value that you specify for ``ES_IDENTIFICATION`` depends on the value of ``ES_IDENTIFICATION_TYPE`` :
- If
ES_IDENTIFICATION_TYPEisDNI_AND_NIF(for Spanish contacts):
- Specify 8 numbers + 1 letter (DNI [Documento Nacional de Identidad], NIF [Número de Identificación Fiscal])
- Example: 12345678M
- If
ES_IDENTIFICATION_TYPEisNIE(for foreigners with legal residence):
- Specify 1 letter + 7 numbers + 1 letter ( NIE [Número de Identidad de Extranjero])
- Example: Y1234567X
- If
ES_IDENTIFICATION_TYPEisOTHER(for contacts outside of Spain):
- Specify a passport number, drivers license number, or national identity card number
ES_IDENTIFICATION_TYPEValid values include the following:
DNI_AND_NIF(For Spanish contacts)NIE(For foreigners with legal residence)OTHER(For contacts outside of Spain)
ES_LEGAL_FORMValid values include the following:
ASSOCIATIONCENTRAL_GOVERNMENT_BODYCIVIL_SOCIETYCOMMUNITY_OF_OWNERSCOMMUNITY_PROPERTYCONSULATECOOPERATIVEDESIGNATION_OF_ORIGIN_SUPERVISORY_COUNCILECONOMIC_INTEREST_GROUPEMBASSYENTITY_MANAGING_NATURAL_AREASFARM_PARTNERSHIPFOUNDATIONGENERAL_AND_LIMITED_PARTNERSHIPGENERAL_PARTNERSHIPINDIVIDUALLIMITED_COMPANYLOCAL_AUTHORITYLOCAL_PUBLIC_ENTITYMUTUAL_INSURANCE_COMPANYNATIONAL_PUBLIC_ENTITYORDER_OR_RELIGIOUS_INSTITUTIONOTHERS (Only for contacts outside of Spain)POLITICAL_PARTYPROFESSIONAL_ASSOCIATIONPUBLIC_LAW_ASSOCIATIONPUBLIC_LIMITED_COMPANYREGIONAL_GOVERNMENT_BODYREGIONAL_PUBLIC_ENTITYSAVINGS_BANKSPANISH_OFFICESPORTS_ASSOCIATIONSPORTS_FEDERATIONSPORTS_LIMITED_COMPANYTEMPORARY_ALLIANCE_OF_ENTERPRISESTRADE_UNIONWORKER_OWNED_COMPANYWORKER_OWNED_LIMITED_COMPANY.eu
EU_COUNTRY_OF_CITIZENSHIP.fi
BIRTH_DATE_IN_YYYY_MM_DD
FI_BUSINESS_NUMBER
FI_ID_NUMBER
FI_NATIONALITYValid values include the following:
FINNISHNOT_FINNISH
FI_ORGANIZATION_TYPEValid values include the following:
COMPANYCORPORATIONGOVERNMENTINSTITUTIONPOLITICAL_PARTYPUBLIC_COMMUNITYTOWNSHIP.it
IT_NATIONALITY
IT_PIN
IT_REGISTRANT_ENTITY_TYPEValid values include the following:
FOREIGNERSFREELANCE_WORKERS(Freelance workers and professionals)ITALIAN_COMPANIES(Italian companies and one-person companies)NON_PROFIT_ORGANIZATIONSOTHER_SUBJECTSPUBLIC_ORGANIZATIONS.ru
BIRTH_DATE_IN_YYYY_MM_DD
RU_PASSPORT_DATA.se
BIRTH_COUNTRY
SE_ID_NUMBER.sg
SG_ID_NUMBER.uk, .co.uk, .me.uk, and .org.uk
UK_CONTACT_TYPEValid values include the following:
CRC(UK Corporation by Royal Charter)FCORP(Non-UK Corporation)FIND(Non-UK Individual, representing self)FOTHER(Non-UK Entity that does not fit into any other category)GOV(UK Government Body)IND(UK Individual (representing self))IP(UK Industrial/Provident Registered Company)LLP(UK Limited Liability Partnership)LTD(UK Limited Company)OTHER(UK Entity that does not fit into any other category)PLC(UK Public Limited Company)PTNR(UK Partnership)RCHAR(UK Registered Charity)SCH(UK School)STAT(UK Statutory Body)STRA(UK Sole Trader)
UK_COMPANY_NUMBERIn addition, many TLDs require a
VAT_NUMBER.Possible values:
DUNS_NUMBERBRAND_NUMBERBIRTH_DEPARTMENTBIRTH_DATE_IN_YYYY_MM_DDBIRTH_COUNTRYBIRTH_CITYDOCUMENT_NUMBERAU_ID_NUMBERAU_ID_TYPECA_LEGAL_TYPECA_BUSINESS_ENTITY_TYPECA_LEGAL_REPRESENTATIVECA_LEGAL_REPRESENTATIVE_CAPACITYES_IDENTIFICATIONES_IDENTIFICATION_TYPEES_LEGAL_FORMFI_BUSINESS_NUMBERFI_ID_NUMBERFI_NATIONALITYFI_ORGANIZATION_TYPEIT_NATIONALITYIT_PINIT_REGISTRANT_ENTITY_TYPERU_PASSPORT_DATASE_ID_NUMBERSG_ID_NUMBERVAT_NUMBERUK_CONTACT_TYPEUK_COMPANY_NUMBEREU_COUNTRY_OF_CITIZENSHIPAU_PRIORITY_TOKENAU_ELIGIBILITY_TYPEAU_POLICY_REASONAU_REGISTRANT_NAMEValue -> (string) [required]
The value that corresponds with the name of an extra parameter.
Constraints:
- max:
2048
BillingPrivacy -> (boolean)
Specifies whether contact information is concealed from WHOIS queries. If the value istrue, WHOIS (“who is”) queries return contact information either for Amazon Registrar or for our registrar associate, Gandi. If the value isfalse, WHOIS queries return the information that you entered for the billing contact.